PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0178s0050.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family B3
Protein Properties Length: 515aa    MW: 58265.1 Da    PI: 4.644
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0178s0050.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B3512.7e-16861651296
                          HTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEE CS
                   B3  12 ksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkv 96 
                          +   l +p  f+++++++  +s +++++de g+ W vk++ +k++++++  +GW++Fv+ ngL+ gD + F+ ++ +++ +v+++
  Kalax.0178s0050.2.p  86 S---LHFPACFCAANKLNVSCS-EIIVKDEAGKAWPVKVKCKKGGNAVYTMGGWRSFVEGNGLQKGDRFNFRIVS-KGKIPVLSF 165
                          3...569999*****9998887.****************9999999999999********************765.444445444 PP

2B332.81.3e-102933741498
                          T-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE- CS
                   B3  14 grlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfr 98 
                            l++p  f +++++++ +  ++ ++d +g+ W v+++ +++ + ++  +GW +  + ng++ gD   F++++  ++++v++++r
  Kalax.0178s0050.2.p 293 TSLYFPVYFSRANNLDS-C-SEIDVKDDRGKLWPVNIRLKRNTNLVYTVGGWTSLIRGNGIRKGDRYEFRVIS-YGTKPVLSFRR 374
                          34689999999999983.4.49***************99999999999**********************987.67778887765 PP

3B345.41.4e-14414506697
                          ..-HHHHTT-EE--HHH.HTT...---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE.. CS
                   B3   6 tpsdvlksgrlvlpkkfaeeh...ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefel 92 
                          ++  +l ++rl l  +fa+ +   +    +s +++l++++g+sW  +l+ +++s r+++t+GW eF+ angL++g ++ +++++ +++ l
  Kalax.0178s0050.2.p 414 ITQASLDRSRLFLGINFAKMNglaD--RDRSGDMILRNSQGKSWVATLKREGNSFRFFITNGWTEFALANGLEAGRVFRLEVVEPESKLL 501
                          4566778889***********7533..347779***************88999999***********************99887666656 PP

                          EEEEE CS
                   B3  93 vvkvf 97 
                          ++k+ 
  Kalax.0178s0050.2.p 502 TLKLT 506
                          66665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086310.377143IPR003340B3 DNA binding domain
CDDcd100171.87E-8641No hitNo description
SuperFamilySSF1019368.24E-11649IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.106.0E-11755IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019364.51E-1768166IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.8E-1570166IPR015300DNA-binding pseudobarrel domain
CDDcd100174.19E-1474167No hitNo description
SMARTSM010198.1E-1375169IPR003340B3 DNA binding domain
PfamPF023622.6E-1485166IPR003340B3 DNA binding domain
PROSITE profilePS5086312.407105168IPR003340B3 DNA binding domain
PROSITE profilePS5086310.941280375IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.104.5E-10280382IPR015300DNA-binding pseudobarrel domain
CDDcd100172.55E-10280374No hitNo description
SuperFamilySSF1019362.55E-12282376IPR015300DNA-binding pseudobarrel domain
SMARTSM010193.4E-10287376IPR003340B3 DNA binding domain
PfamPF023627.0E-9294374IPR003340B3 DNA binding domain
CDDcd100171.83E-12409500No hitNo description
SuperFamilySSF1019361.57E-14409501IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086312.731409509IPR003340B3 DNA binding domain
SMARTSM010192.7E-13410509IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.3E-12411503IPR015300DNA-binding pseudobarrel domain
PfamPF023625.7E-13413508IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009793Biological Processembryo development ending in seed dormancy
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 515 aa     Download sequence    Send to blast
MVGRSIVDGW AEFADAHELK VGYFLVFKYD GGTVFHVSVF DPSACEVEYG DEHDEDNAVE  60
GDGEELKMDS GQTSYVGTLR PSYLISLHFP ACFCAANKLN VSCSEIIVKD EAGKAWPVKV  120
KCKKGGNAVY TMGGWRSFVE GNGLQKGDRF NFRIVSKGKI PVLSFRRIGG MRDQTEVATR  180
AKRRKAVEVP KLDTSAGEVE HPSLDEDEDD DVEQDDEEDT VEEDDDEDLL EEDEEEEDMV  240
EEDYDEEEDM VDGDDEEHKT ELDHSRKRMK NRNPDTDEST ASYVGKMCRA YLTSLYFPVY  300
FSRANNLDSC SEIDVKDDRG KLWPVNIRLK RNTNLVYTVG GWTSLIRGNG IRKGDRYEFR  360
VISYGTKPVL SFRRIGPKRK AGLEEEEKVP ELALRHFEKT TGSLIPGTYL IRTITQASLD  420
RSRLFLGINF AKMNGLADRD RSGDMILRNS QGKSWVATLK REGNSFRFFI TNGWTEFALA  480
NGLEAGRVFR LEVVEPESKL LTLKLTRRVT LEDL*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1265271RKRMKNR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24645.11e-26B3 family protein